PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0189s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 463aa    MW: 52443.6 Da    PI: 7.9196
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0189s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.11.6e-132099797
                         .-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
                   B3  7 psdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                         +sd  ++  + +p +f++  +g+  e     l++ ++ r W v++   +++    + +GW+eFv++n+L +g+++vF++dg ++f   v+vf
  Kalax.0189s0013.1.p 20 TSDLATN--FLIPADFCKYLEGQRGE--AAELRSrRRRRPWPVRI--VGRR----IVDGWEEFVRENELHVGEILVFRYDGGMCF--DVTVF 99
                         5555555..79******555888555..67777846779******..7777....889**********************99*99..77776 PP

2B3391.4e-121562381498
                          T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                          + l +p +f+ ++++kk++s  ++++de+g+sW vkl ++k ++++  ++GW +F k+ g++eg+ +  ++++ +++++v++++r
  Kalax.0189s0013.1.p 156 RSLFFPVPFILDNQLKKARS-GIVVRDEKGKSWPVKLGFKKWGNSVCTRDGWYSFIKETGIREGEDFEVRVIS-QGRKPVLTFRR 238
                          33789**********99998.9*****************999999*******************998888776.66667777665 PP

3B3469.5e-15360448996
                          HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy..rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                           + +++rlv+  +fa++++++++++  ++l++++g+ W  +l+y  +k++++y++++GWkeF+ +ngL +g  + ++ ++ ++ +l++k+
  Kalax.0189s0013.1.p 360 PMIERSRLVVGVEFARANDLINKCG-SIILKNQKGEPWAATLKYtkKKTQDSYYISAGWKEFALSNGLGVGCQFKLEIEQPESDTLTFKL 448
                          567899************9998777.9*****************64555555*******************9988887766888788776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.4E-1711104IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.92812102IPR003340B3 DNA binding domain
SuperFamilySSF1019361.14E-1712109IPR015300DNA-binding pseudobarrel domain
CDDcd100174.54E-121399No hitNo description
SMARTSM010192.9E-1315102IPR003340B3 DNA binding domain
PfamPF023622.4E-102397IPR003340B3 DNA binding domain
PROSITE profilePS508639.982143239IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-11143237IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-13145238IPR015300DNA-binding pseudobarrel domain
CDDcd100179.52E-10145250No hitNo description
SMARTSM010196.9E-9146240IPR003340B3 DNA binding domain
PfamPF023621.1E-10156238IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.6E-12352439IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.251352452IPR003340B3 DNA binding domain
SMARTSM010191.3E-5353450IPR003340B3 DNA binding domain
PfamPF023623.9E-13358448IPR003340B3 DNA binding domain
SuperFamilySSF1019361.55E-12362437IPR015300DNA-binding pseudobarrel domain
CDDcd100173.74E-16364458No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MADEERSQFP TGPHFLQPVT SDLATNFLIP ADFCKYLEGQ RGEAAELRSR RRRRPWPVRI  60
VGRRIVDGWE EFVRENELHV GEILVFRYDG GMCFDVTVFG PSACEKEFPP LATSPAAADE  120
NLELEETAAI RGDGLNCPPQ AGTDSYVGTM KPSYLRSLFF PVPFILDNQL KKARSGIVVR  180
DEKGKSWPVK LGFKKWGNSV CTRDGWYSFI KETGIREGED FEVRVISQGR KPVLTFRRIS  240
NEENSRVSEF ENRQKADQVS EPKIEPITRQ MADQAREPEM EPMPKPAKRQ EAEEVRVPET  300
EWMATPAKKQ KTMEVPVPET EWVATSAKRH KVQGHTLTEQ KTDSPRAVRC TYFYATSTWP  360
MIERSRLVVG VEFARANDLI NKCGSIILKN QKGEPWAATL KYTKKKTQDS YYISAGWKEF  420
ALSNGLGVGC QFKLEIEQPE SDTLTFKLSE CLPGKLRVGD SA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.15e-31B3 family protein